Certified Chimney Sweeps in St. Louis, MO — 14 CSIA-Certified Companies Verified

23 verified companies 14 CSIA-certified Updated April 2026

St. Louis presents one of the most demanding chimney markets in the country. The bi-state metro (Missouri and Illinois Metro East) is built on a dense fabric of 19th- and early-20th-century masonry housing—neighborhoods like Soulard (1840s–1880s), Lafayette Square (1860s–1890s), Tower Grove, The Hill, and Central West End contain block after block of original clay-brick chimneys requiring regular maintenance. The freeze-thaw cycle in the Missouri River Valley is severe, with temperatures routinely swinging 40–50°F in a single day during shoulder seasons, accelerating mortar deterioration and spalling at an above-average rate. Our research confirmed 14 CSIA-certified companies serving the metro, anchored by two of the most credentialed operators in the entire Midwest: Gregg Boss of English Sweep (the only CSIA Master Chimney Sweep in Missouri, in business since 1979) and Victor Imgarten of Clean Sweep Chimney Service (the longest CSIA-certified sweep in Missouri and a past president of both the NCSG and CSIA, in business since 1978).

Missouri imposes no statewide contractor licensing for chimney sweeps, making the St. Louis market uniquely vulnerable to fraud. Our research documented 13 or more confirmed or suspected spam and lead-generation operations actively targeting metro ZIP codes—including a Virginia Beach company (chimneysweep.com) with BBB complaints describing threats and $15,000 upsell attempts, a Dallas-based operation (Ace Fireplace Services) with a BBB D+ rating dispatching to St. Louis without local staff, an F-rated operator (A-1 Chimney Sweep) with unresolved BBB complaints, and a network of at least 14 keyword-stuffed “[city]chimneysweep.us” doorway domains with no verifiable business entities behind them. Documented fraudulent operations outnumber CSIA-certified companies in search results for most St. Louis ZIP codes. Missouri’s zero-licensing environment means any company can claim “certified” with no legal consequence.

Every company in this directory was evaluated through CSIA credential verification via search.csia.org (confirmed profile URLs where available), NCSG member directory cross-reference, BBB accreditation history, physical address verification, multi-platform review analysis, and phone number ownership patterns. Only CSIA- and NCSG-confirmed companies or thoroughly verified long-standing operators appear in the non-flagged tiers. Any company using a toll-free-only number, lacking a verifiable street address, or matching multiple spam signals from our 12-point checklist is documented in the flagged section. Legitimate chimney cleaning in St. Louis costs $179–$300+; any advertised price below $100 should be treated as a bait-and-switch indicator.

Quick Reference — St. Louis Chimney Services
CSIA-Certified Companies
14 verified
Total Verified
24 companies
Basic Sweep (Level 1)
$179–$300
Level 2 Inspection
$200–$500
Relining (stainless)
$900–$3,500+
Suspected Spam GBPs
13+ flagged
How to Verify CSIA
search.csia.org
How to Verify NCSG
ncsg.org/find-a-chimney-sweep
Last Verified
April 2026

English Sweep, Inc.

CSIA CCS CSIA Master Chimney Sweep NFI Certified NCSG Voting Member NCSG Honorary Master Chimney Professional Licensed / Insured Est. 1979 Verify on CSIA → Verify on NCSG →
Address
938 St. Louis Ave, Valley Park, MO 63088
Service Area
St. Louis County, St. Charles County, Franklin County, Jefferson County, Monroe County IL, Washington County IL
CSIA Level
CCS (confirmed — search.csia.org/company_profile/english-sweep-inc); Owner Gregg Boss holds CSIA Master Chimney Sweep — the only one in Missouri
NFI Certified
Yes — multiple NFI-certified sweeps on staff
Other Certs
NCSG Voting Member; NCSG Honorary Master Chimney Professional; ASHI Member; Midwest Chimney Safety Council; West St. Louis County Chamber of Commerce
Owner
Gregg Boss (owner since 1983)
Years in Business
47 years (since 1979); largest certified crew in the St. Louis area
Specializations
All 3 NFPA 211 inspection levels, chimney construction, emergency services, fireplace sales (Bellfires, Prior, Cozy Heat, Empire, Heat & Glo), smoking fireplace diagnostics, water-damaged wall repair, gas/utility cease orders, dryer vent cleaning, air duct cleaning
The strongest credential profile in the St. Louis metro—Gregg Boss is the only CSIA Master Chimney Sweep in Missouri and an NCSG Honorary Master Chimney Professional, operating since 1979 with the area's largest certified crew. CSIA profile confirmed at search.csia.org. Serves a wide six-county bi-state footprint including Franklin, Jefferson, Monroe, and Washington counties. Fireplace sales showroom featuring Bellfires, Prior, Cozy Heat, Empire, and Heat & Glo brands. Past board member of multiple industry organizations; capable of resolving gas utility cease orders and smoke diagnostic emergencies that smaller companies decline.

Clean Sweep Chimney Service

CSIA CCS NFI Certified NCSG Voting Member NCSG Honorary Master Chimney Professional Est. 1978 Verify on CSIA → Verify on NCSG →
Address
4004 Emerald Drive, St. Charles, MO 63304
Service Area
St. Louis County, St. Charles County
CSIA Level
CCS — Owner Victor Imgarten is the longest CSIA-certified chimney sweep in Missouri and a past president of both the NCSG and CSIA
NFI Certified
Yes (NFI certified)
Other Certs
NCSG Voting Member; NCSG Honorary Master Chimney Professional; NCSG President’s Award; Leavitt Award; Groah-Bures Award
Owner
Victor Imgarten
Years in Business
48 years (since 1978) — St. Louis’ oldest chimney sweep service; 50,000+ chimneys serviced
Specializations
Historical chimney renovations, IR camera/blower door testing for smoke problems, HEPA vacuum systems, fireplace construction, chimney relining, European chimney lining/sweeping methods, power sweeping, video chimney inspections
St. Louis’s oldest chimney sweep service, operating since 1978 under Victor Imgarten—the longest CSIA-certified sweep in Missouri and a past president of both the CSIA and the NCSG. The company was first in Missouri to offer internal video chimney inspections and has serviced 50,000+ chimneys. Industry honors include the NCSG President’s Award, Leavitt Award, and Groah-Bures Award. Specializes in historical chimney renovation and European sweeping methods particularly relevant to St. Louis’s 19th-century masonry housing stock.

The Mad Hatter Service Company

CSIA CCS Est. 40+ yrs Verify on CSIA →
Address
1109 E Terra Ln, O’Fallon, MO 63366
Service Area
St. Louis County, St. Charles County
CSIA Level
CCS (confirmed — search.csia.org/company_profile/the-mad-hatter-of-mo)
Legal Name
dba A & J Mack Enterprises Inc.
Contacts
Annie Mack, Kim Boldt, Joe Mack Sr.
Years in Business
40+ years; 80,000+ clients served
Specializations
Chimney sweeping, air duct cleaning, dryer vent cleaning, chimney repair, tuckpointing, inspections; also operates “The Chimney Safety Firm” — a forensic-level diagnostic/inspection division
One of the largest chimney service operations in the metro with 80,000+ clients served over 40+ years. CSIA profile confirmed at search.csia.org. Also operates “The Chimney Safety Firm,” a separate forensic-level diagnostic and inspection division handling complex smoke problems and liability inspections. Full-service operation covering chimney sweeping, air duct cleaning, dryer vents, tuckpointing, and masonry repair across St. Louis and St. Charles counties.

STL Chimney / St. Louis Chimney Co.

CSIA CCS NCSG Voting Member Est. 2013 Verify on CSIA → Verify on NCSG →
Address
120 N. Main Street, St. Charles, MO 63301
Service Area
Bi-state — Missouri and Illinois (explicitly stated)
CSIA Level
Employs CSIA-certified technicians (confirmed — search.csia.org/company_profile/stl-chimney)
Other Certs
NCSG Voting Member
Years in Business
Founded 2013; 10,000+ chimneys serviced
Specializations
Chimney sweeping/cleaning, inspections, gas fireplace services (direct vent, gas inserts, gas logs), exterior masonry repairs, chimney chase covers, custom chimney caps, flue liner installation (stainless steel, aluminum, Cerfractory), dryer vent cleaning, tuckpointing, crown repair, brick rebuilds
CSIA- and NCSG-confirmed bi-state operation based in historic downtown St. Charles, with 10,000+ chimneys serviced since founding in 2013. One of the few companies in the metro that explicitly advertises service coverage on both the Missouri and Illinois sides. Offers a full lineup of gas fireplace services (direct vent, gas inserts, gas logs) alongside traditional chimney work, plus Cerfractory flue liner installation and full masonry rebuilds.

All Gas Installation and Fireplace

CSIA CCS CCP Master Chimney Technician NFI Gas Specialist NCSG Member Licensed / Insured Est. ~2006 Verify on CSIA → Verify on NCSG →
Address
1 Ferndale Dr, Fenton, MO 63026
Service Area
St. Louis metro, Jefferson County, Franklin County, St. Charles County
CSIA Level
CSIA Certified Chimney Sweep + CCP Certified Master Chimney Technician
NFI Certified
NFI Certified Gas Specialist
Other Certs
NCSG Member; Midwest Hearth Patio & Barbecue Association member
BBB
A+ (Accredited)
Years in Business
20+ years
Specializations
Gas fireplace specialist: wood-to-gas conversions, gas log/fireplace sales/service/repair, chimney sweeps, home sale inspections, chimney caps, chase covers, fireplace remote controls, gas grill sales & service, gas light/lamp/lantern service. No subcontractors used.
Holds the strongest gas-specialization credential stack in the metro: CSIA CCS, CCP Certified Master Chimney Technician, NFI Gas Specialist, and NCSG membership. BBB A+ accredited, 20+ years in business, and explicitly no-subcontractor. The go-to company for wood-to-gas conversions, gas insert/log repair, and home sale gas inspections across four counties. Locally owned Fenton operation serving St. Louis, Jefferson, Franklin, and St. Charles counties.

Bone Dry Roofing St. Louis

CSIA CCS Est. (national co.) Verify on CSIA →
Address
5895 Suemandy Dr, St. Peters, MO 63376
Service Area
St. Louis, St. Charles, and surrounding communities
CSIA Level
Employs CSIA-certified technicians (confirmed — search.csia.org/company_profile/bone-dry-roofing-st-louis)
Structure
National company with local St. Louis branch
Specializations
Chimney repair, chimney inspection, chimney cleaning/sweeping, chimney caps/covers, masonry services, chimney rebuild; also roofing, siding, insulation, gutters
Local branch of Bone Dry Roofing, a national company with a confirmed CSIA profile (search.csia.org/company_profile/bone-dry-roofing-st-louis) and CSIA-certified technicians on staff in the St. Louis location. Well suited for homeowners who need chimney work combined with a roof or exterior inspection in the same visit. Serves St. Louis and St. Charles areas from the St. Peters branch office.
Bone Dry is a national franchise company. While CSIA certification is confirmed for this branch, homeowners should confirm that the assigned technician holds current CSIA credentials at the time of service.

The Chimney Sweep Experts

CSIA CCS NCSG Voting Member Licensed / Insured Est. 2017 Verify on CSIA → Verify on NCSG →
Address
10635 Liberty Ave, St. Louis, MO 63132
Service Area
Bi-state — full MO metro plus Madison County IL, St. Clair County IL, Alton, Belleville, Caseyville, Collinsville, East St. Louis, Edwardsville, Fairview Heights, Granite City, Highland IL
CSIA Level
CSIA certified (claimed); NCSG Voting Member confirmed at ncsg.org/member/the-chimney-sweep-experts-2
Owner
Omar A. Quijada
BBB
A+ (Accredited since 2019)
Years in Business
Est. 2017; personnel with 16+ years chimney experience
Specializations
Chimney cleaning/visual inspection, camera inspection, cap installation, troubleshooting, damper installation, tuckpointing, masonry water repellent, tear-down/rebuild, flue liners, dryer vent cleaning; Level 1 and 2 NFPA inspections
NCSG Voting Member (confirmed at ncsg.org) and CSIA-certified company based in St. Louis City, with BBB A+ accreditation since 2019. One of the few metro-area operations explicitly listing bi-state service coverage including eight Illinois Metro East cities on their BBB profile. Owned by Omar A. Quijada; personnel carry 16+ years of chimney experience. Offers Level 1 and Level 2 NFPA 211 inspections alongside full repair and relining services.

SirVent STL Chimney & Venting Service

CSIA CCS Licensed / Insured Est. (franchise) Verify on CSIA →
Address
Based in Jackson, MO 63755 (per BBB/Yelp); serves St. Louis metro
Service Area
St. Louis County, St. Louis City, Jefferson County, Sainte Genevieve, Perry, Cape Girardeau, Scott, St. Francois, Bollinger counties
CSIA Level
CSIA certified per website; listed on legacy web.ncsg.org directory (current ncsg.org listing not confirmed — membership may have lapsed)
Structure
SirVent franchise operation; military family (Mike and Afton, father/son)
Awards
BBB Torch Award for Ethics 2022
Specializations
Chimney sweeping, inspections, chimney repairs, masonry repairs, chimney relining, waterproofing, dryer vent cleaning, chase cover replacement, chimney cap replacement, flashing, crown repair, smoke chamber repair, energy top dampers
Military family-owned SirVent franchise serving St. Louis City/County and a broad south/southeast Missouri footprint including Jefferson County. Won the BBB Torch Award for Ethics in 2022, the BBB’s highest recognition for marketplace integrity. CSIA certification is self-reported via website. Note: the 573 area code is outside the primary metro but the company actively markets to and serves St. Louis City and County.
SirVent STL is a franchise operation. CSIA certification is claimed on the website but was not confirmed via a direct search.csia.org profile URL. NCSG membership appeared on a legacy directory but was not confirmed on the current ncsg.org member list. Verify current credentials before booking.

Welsch Chimney Service Inc.

CSIA CCS Licensed / Insured Est. 1988 Verify on CSIA →
Service Area
St. Louis, St. Charles, St. Peters, Florissant, Chesterfield, Clayton, University City, Cottleville, O’Fallon
CSIA Level
CSIA member with certified team (claimed)
Years in Business
38 years (since 1988), family-owned
Specializations
No-mess chimney cleaning, masonry & leak repair, stainless steel chimney caps, top-sealing dampers, flue & chimney liner repair, smoke & draft solutions, animal removal, dryer vent and furnace flue cleaning, Level 1/2 inspections with written reports
Family-owned 38-year operation serving the central St. Louis County and St. Charles County corridor. Clean BBB record; references local landmarks including the Gateway Arch and Forest Park in service materials. CSIA certification is claimed for the team but not confirmed via a direct profile URL. Provides written inspection reports with Level 1 and Level 2 chimney inspections and offers top-sealing damper and stainless cap installation.
CSIA certification is claimed on the website but was not confirmed via a direct search.csia.org profile URL. Verify current credentials directly before booking.

Gateway Chimney Service, LLC

CSIA CCS Licensed / Insured Est. 40+ yrs Verify on CSIA →
Address
6810 Scanlan Ave, Saint Louis, MO 63139
Service Area
St. Louis metropolitan area (bi-state based on Angi/Yelp IL appearances)
CSIA Level
CSIA certified chimney sweeps (claimed)
Owner
Mike (referenced in reviews)
Years in Business
40+ years, family-owned
Specializations
Chimney cleaning, inspection, repair, restoration, cap/crown installation, gas and wood insert maintenance, flue liner solutions, masonry work
Family-owned 40+ year operation with a verified St. Louis City address on Scanlan Ave. Covers the full range of chimney and fireplace services including cleaning, inspection, restoration, cap and crown work, gas and wood insert maintenance, and masonry repair. CSIA certification is self-reported on the company website. Strong local review profile; appears in both Missouri and Illinois Metro East search results.
CSIA certification is claimed on the website but was not confirmed via a direct search.csia.org profile URL. Verify current credentials directly before booking.

Fireside Hearth & Home (Arnold Stove & Fireplace Center)

CSIA CCS NCSG Member Licensed / Insured Est. 1986 Verify on CSIA → Verify on NCSG →
Address
Arnold, MO (Jefferson County — showroom)
Service Area
Jefferson County, southern St. Louis County
CSIA Level
CSIA certified in-house chimney sweeps (not subcontracted)
Other Certs
NCSG Member
Owner
Moss family
Years in Business
40 years (since 1986), family-owned
Specializations
Chimney sweeping/cleaning, Level 2 camera inspections, real estate chimney inspections, wood stove/fireplace/insert sales; 80+ burning displays in showroom
Family-owned Arnold hearth retailer with an in-house CSIA-certified sweep team serving Jefferson County and southern St. Louis County for 40 years. Particularly active in real estate transaction chimney inspections, working closely with area realtors. Chimney work is done in-house (not subcontracted) — a meaningful commitment for a retailer. Showroom features 80+ burning fireplace displays. NCSG member.

Maine Chimney Sweep Ltd.

CSIA CCS NCSG Member Licensed / Insured Est. 1979 Verify on CSIA → Verify on NCSG →
Address
2010 East B Street, Belleville, IL 62221
Service Area
Illinois Metro East only — Belleville, Collinsville, Edwardsville, Fairview Heights, Granite City, O’Fallon IL, Swansea, Shiloh, Highland, Troy, Glen Carbon, Alton, Caseyville, Cahokia, Columbia, Waterloo, Mascoutah
CSIA Level
CSIA certified (confirmed — search.csia.org/company_profile/maine-chimney-sweep-ltd)
Other Certs
NCSG Member
Owner
Austin Hayden
BBB
A+ (Accredited; file opened 2003)
Years in Business
47 years (since 1979)
Specializations
Chimney cleaning/sweeping, camera inspections, visual inspections, chimney cover installation, fireplace installation/insert installation, chimney/fireplace repair, animal & nesting removal, dryer vent cleaning, masonry repair, chimney liners & inserts, chimney covers/crowns, product sales
The gold standard for Illinois Metro East: longest-established and most credentialed CSIA/NCSG company on the Illinois side, in business since 1979 with a CSIA profile confirmed at search.csia.org and BBB A+ accreditation since 2003. Serves a comprehensive list of St. Clair and Madison county communities but covers Illinois only — does not cross the river. Full-service chimney operation under owner Austin Hayden.
Maine Chimney Sweep serves Illinois Metro East exclusively. Homeowners on the Missouri side should contact one of the MO-based certified companies above.

Wiegmann Woodworking & Fireplaces, Inc.

CSIA CCS NFI Gas & Woodburning NCSG Member HPBA Member Licensed / Insured Est. 1999 Verify on CSIA → Verify on NCSG →
Address
105 Sugar Creek Ln, Damiansville, IL 62215
Service Area
Damiansville, Breese, New Baden, Trenton, Lebanon, Mascoutah, Edwardsville, Highland, Fairview Heights, Shiloh, Maryville, Mt. Vernon
CSIA Level
Two CSIA Certified Chimney Sweeps on staff: Todd Busch, CCS, CSIA License #7908 (certified since April 2012)
NFI Certified
NFI Gas & Woodburning certified employees
Other Certs
NCSG Member; HPBA Member
Owner
Teresa A. Wiegmann; veteran/family-owned
BBB
A+ (Accredited)
Years in Business
Incorporated 1999
Specializations
Fireplace sales/installation (wood-burning, gas, pellet), chimney sweeping and inspections (Level 1 & 2), custom fireplaces, custom mantels, outdoor kitchens, doors & trim, stone/marble work; 50+ working displays in showroom. Payment for chimney services: cash or check only.
Veteran-owned Illinois Metro East hearth retailer/installer with two named CSIA-certified technicians on staff, including Todd Busch (CCS License #7908, certified since 2012) — an unusually specific and verifiable credential disclosure. NFI gas and woodburning certified employees. BBB A+ accredited. Showroom features 50+ working fireplace displays. Note: chimney service payments are cash or check only; no cards accepted for that service line.

Home & Leisure Lifestyles, LLC

CSIA CCS NFI Gas & Wood NCSG Voting Member Licensed / Insured Est. 2003 Verify on CSIA → Verify on NCSG →
Address
30 Stone Dr, Highland, IL 62249 (home-based, by appointment only)
Service Area
Highland, Edwardsville, Collinsville, O’Fallon IL, and broader Metro East
CSIA Level
CSIA member (confirmed)
NFI Certified
NFI Certified (Gas and Wood fireplace installation)
Other Certs
NCSG Voting Member (confirmed at ncsg.org/member/home-leisure-lifestyles-llc-2)
Owner
Tom Vice (President, 30+ years experience); Nathan Vice
BBB
A+
Years in Business
Founded 2003
Authorized Dealer
Regency, Vermont Casting, White Mountain Hearth, Blaze King
Specializations
Chimney cleaning, inspections, tuckpointing, waterproofing, masonry repairs, video inspections, chimney/gas fireplace installations, fire safety inspections, pellet/wood/gas stove installation and service, dryer vent cleaning, duct cleaning
Holds the strongest certification profile of any Illinois-side company: CSIA member, NCSG Voting Member (confirmed at ncsg.org), and NFI certified for both gas and wood fireplace installation — a triple-certification stack. BBB A+ rated; home-based operation by appointment, which is disclosed upfront. Owner Tom Vice carries 30+ years of chimney experience. Authorized dealer for Regency, Vermont Casting, White Mountain Hearth, and Blaze King.
Home-based operation; by appointment only. This is disclosed upfront and does not indicate reduced service quality for an experienced sole-proprietor operation.

A.I.O Pro Chimney (All In One Pro)

NCSG Voting Member Licensed / Insured Verify on NCSG →
Address
4826 Pennsylvania Avenue, St. Louis, MO 63111
Service Area
Greater St. Louis area
NCSG Status
Voting Member (confirmed at ncsg.org/member/a-i-o-pro-chimney)
Specializations
Inspections, sweeping, relining, dryer vent cleaning, installation, masonry repair, chimney caps, crown repair, waterproofing, brick sealing, fireplace restoration, animal removal, air duct cleaning, gas fireplace repair/installation, stainless steel liner installation, chase cover replacement, emergency services
NCSG Voting Member confirmed at ncsg.org — the primary professional credential available. No CSIA certification was listed on the NCSG profile. Active social media presence with video content showing real chimney work. Two addresses appear across different platforms (Pennsylvania Ave and North and South Rd), possibly reflecting a moved or home-based operation. Full-service chimney and fireplace company with emergency service availability.
CSIA certification was not listed on the NCSG profile. Verify whether CSIA certification has been obtained since the directory was compiled, and confirm current address before scheduling.

Holy Smoke Chimney Service

NCSG Voting Member Licensed / Insured Est. 40+ yrs Verify on NCSG →
Address
105 N Main Street, Suite 102, St. Charles, MO 63301 (NCSG); also 6859 Bear Creek Dr, Saint Louis, MO 63129 (BBB)
Service Area
St. Louis and Metro East (per NCSG: “across St. Louis and Metro East”)
NCSG Status
Voting Member (confirmed at ncsg.org/member/holy-smoke-chimney-service)
BBB
A+ (Accredited since 2016)
Legal Entity
Holy Smoke STL LLC
Years in Business
40+ years (per NCSG bio); 30+ years (per BBB)
Specializations
Tuckpointing, waterproofing, chimney caps and covers, chase caps, inspections, cleanings
Long-established bi-state chimney service with NCSG Voting Member status confirmed at ncsg.org and BBB A+ accreditation since 2016. ThreeBestRated.com recognition. Per the NCSG bio, the company was founded over 40 years ago and is described as a trusted leader across St. Louis and Metro East. Multiple addresses across platforms likely reflect mailing versus operational locations rather than indicating any concern.
CSIA certification was not confirmed. The NCSG Voting Member designation is the primary verified professional credential.

Chimneys Unlimited

Licensed / Insured Est. 30+ yrs Verify on CSIA →
Address
1031 Woodland Trails Dr, Fenton, MO 63026
Service Area
Fenton, Chesterfield, Wildwood, Kirkwood, Webster Groves, Creve Coeur, Ballwin, Manchester, Town and Country, Ladue, Sunset Hills, Mehlville, Oakville
CSIA/NFI/NCSG
None claimed
BBB
A+
Owner
Bob (38+ years experience)
Years in Business
30+ years
Specializations
Chimney inspections, chimney cleaning, chase top covers, chimney covers, dryer vent cleaning, tuckpointing, brick & stonework, mortar repair, damper repairs & installation, fireplace door repairs & installation, bird/squirrel guards. Fully insured.
Fenton-based 30+ year operation owned by Bob, who brings 38+ years of hands-on chimney experience. BBB A+ rated; recommended by Gas Appliance Service at Centerline. Known in local review forums for giving honest assessments and helping homeowners over the phone without charging a service call. Serves the south and west St. Louis County corridor from Fenton through Chesterfield and Kirkwood.
No CSIA, NFI, or NCSG credentials are claimed. For Missouri’s unlicensed market, certification from CSIA or NCSG membership represents additional consumer protection that this company does not provide.

Ash Wipers Chimney Sweep Inc.

Licensed / Insured Est. 1993 Verify on CSIA →
Address
741 Castle Ridge Dr, Ballwin, MO 63021
Service Area
Ballwin, Brentwood, Chesterfield, Clayton, Crestwood, Creve Coeur, Fenton, Glendale, Kirkwood, Ladue, Manchester, Mehlville, Oakville, Rock Hill, Sappington, Shrewsbury, Sunset Hills, Town and Country, University City, Valley Park, Warson Woods, Webster Groves, Wildwood, Winchester, St. Louis
CSIA/NFI/NCSG
None claimed
BBB
Accredited member
Years in Business
33 years (since 1993), family-owned
Specializations
Chimney cleaning, inspections, repairs, total rebuilding
Family-owned Ballwin operation serving 25 named St. Louis County communities for 33 years since 1993. BBB accredited member. Covers one of the widest explicitly-stated service areas of any non-certified company in the metro, running from Webster Groves and Kirkwood through Chesterfield and into West County. No certification red flags; residential address is consistent with small chimney businesses.
No CSIA, NFI, or NCSG credentials are claimed. In Missouri’s unlicensed market, CSIA and NCSG credentials remain the primary independent verification pathway.

Ashes Away Chimney Service

Licensed / Insured Est. 40+ yrs Verify on CSIA →
Address
House Springs / High Ridge, MO 63049 (Jefferson County)
Service Area
St. Louis & northern Jefferson County
Certifications
Certified for Level 1, 2 & 3 chimney inspections; Gas, Pellet & Wood certified specialist (per Angi)
BBB
Accredited
Reviews
4.8/5 on Angi; 4.5 stars on Yelp
Years in Business
~40 years, father & son company
Pricing
~$279 for cleaning; $20 multi-chimney discount
Specializations
Chimney cleaning, inspections (all 3 levels), chimney repair, chimney cap installation, damper repair, camera inspections, masonry repair, stove removal/disposal
Jefferson County father-and-son operation with approximately 40 years of combined experience. Carries informal certifications for all three NFPA inspection levels and gas/pellet/wood specializations per Angi, though not through CSIA or NCSG. BBB accredited; 4.8/5 on Angi across multiple reviews. No website is a minor limitation but the strong word-of-mouth review record and transparent pricing (~$279 sweep) compensate. Pricing is in the legitimate range.
No standalone website; no CSIA or NCSG credentials. “Certified” descriptions on Angi refer to self-reported or third-party platform designations, not CSIA or NCSG credentials.

Scott's Chimney Service

Licensed / Insured Est. 40+ yrs Verify on CSIA →
Address
Dittmer, MO (Jefferson County/Franklin County area)
Service Area
Jefferson County, St. Louis County, Franklin County, St. Charles County
Owner
Kirk Scott
BBB
A+
CSIA
References CSIA recommendations; does not explicitly claim certification
Years in Business
40+ years
Pricing
$189 sweep + inspection; $150 inspection only
Specializations
Chimney sweeping, flue brushing, damper repair, chimney crown repair (CrownSeal® with 10-year warranty), waterproofing, chimney cap installation, wood stove installation (Lopi, Napoleon brands), dryer vent cleaning
Owner-operated Jefferson County company run by Kirk Scott with 40+ years in the business. BBB A+ rated with a stated no-upsell philosophy explicitly advertised on the website — an unusual and credibility-building claim. Pricing is transparent ($189 sweep + inspection) and in the legitimate range. References CSIA recommendations in materials but does not claim personal certification. Installs Lopi and Napoleon wood stoves. Four-county service footprint.
Kirk Scott references CSIA standards but does not claim personal CSIA certification. Verify directly before booking.

Approved Home Improvements (AHI)

HeatShield Certified Licensed / Insured Est. 1991 Verify on CSIA →
Service Area
St. Louis County, Jefferson County; Ballwin, Oakville, St. Charles neighborhoods referenced
Owner
James (meets every homeowner personally)
BBB
A+
Certifications
HeatShield Certified Installer; Veteran-Owned Business
Years in Business
35+ years (since 1991)
Pricing
$179 chimney sweep (promotional)
Specializations
Chimney sweeping, chimney repair, tuckpointing, camera inspections, dryer cleaning, stucco chimney repair, flue liner replacement, full masonry restoration, waterproofing, crown repair, damper repair/replacement
Veteran-owned, 35-year operation with HeatShield Certified Installer credentials — a meaningful specialty certification for flue liner repair. Owner James personally meets every homeowner. BBB A+ rated. In-house team only; no subcontractors. Promotional $179 chimney sweep pricing includes bundled upsell opportunities but is transparent and within the legitimate range for the market. Strong Google rating with hundreds of reviews.
No CSIA or NCSG credentials. HeatShield certification is a manufacturer-specific credential for a flue relining system, not a general chimney industry certification.

Clean Sweep Chimney Services Inc.

Licensed / Insured Est. 2010 Verify on CSIA →
Address
30 Ramsgate, Collinsville, IL 62234
Service Area
Bi-state — Collinsville, St. Louis, East St. Louis, Belleville, Fairmont City, Troy
Owner
Clay
CSIA
CSIA Certified Chimney Sweep badge on website (not independently confirmed on search.csia.org)
Years in Business
~16 years (established 2010)
Specializations
Chimney cleaning, chimney repair, chimney caps, tuckpointing, flashing repair, dryer vent cleaning/repair, fireplace maintenance, chimney liners, crown repair, waterproofing
Collinsville-based sole-proprietor operation run by Clay with 16 years of service covering both the Illinois Metro East and Missouri sides of the metro. CSIA badge displayed on website but not confirmed via a direct search.csia.org profile URL. Facebook page with 212+ likes and multiple reviews citing Clay by name with before/after photos. Residential Collinsville address is typical for this type of small chimney business.
CSIA certification is displayed on the website but was not independently confirmed via a direct search.csia.org profile URL. Verify certification directly before scheduling. Note: this is a different company from “Clean Sweep Chimney Service” in St. Charles, MO (Victor Imgarten).

Hearth & Home Service & Construction

Licensed / Insured Est. 44+ yrs exp Verify on CSIA →
Address
3624 George Leilich Road, New Athens, IL 62264
Service Area
New Athens area, greater Metro East — Belleville, O’Fallon, Mascoutah, Freeburg, Red Bud, Smithton (St. Clair County)
Owner
Joseph Bolin
BBB
A+ (Accredited since 2004)
CSIA/NFI/NCSG
Not explicitly claimed; insured and bonded
Years in Business
Started sweeping 1982; building/restoring 1977; 44+ years sweeping experience
Authorized Dealer
Travis Industries (Fireplace Xtrordinair, Lopi, DaVinci, Avalon)
Specializations
Chimney sweep & cleaning, chimney repair, custom fireplace design, heating unit sales, chimney liners, rain caps, water leak repairs, gas and wood fireplace/stove installation, air duct cleaning, fireplace remodeling, chimney inspection
New Athens, IL family business with 44+ years of chimney sweeping experience (since 1982) and construction experience since 1977. BBB A+ accredited since 2004. Authorized Travis Industries dealer (Fireplace Xtrordinair, Lopi, DaVinci, Avalon). Serves St. Clair County communities in the southern Metro East. No CSIA or NCSG credentials claimed, but the depth of experience and long-standing BBB record distinguish this company from uncredentialed newer operators.
No CSIA or NCSG credentials claimed. The long operating history and BBB track record are the primary legitimacy indicators.
Show more listings

A Step in Time Chimney Sweep (chimneysweep.com)

⚠ Confirmed Lead-Gen / Fraud
Advertised Phone
(314) 244-6639 (local redirect only; HQ: (757) 244-6639, Virginia Beach, VA)
Actual HQ Address
696 S Rosemont Rd, Virginia Beach, VA 23452 — no St. Louis physical address
Website
chimneysweep.com (St. Louis page URL contains misspellings: “st-loius” and “moisuri”)
BBB Status
NOT BBB Accredited (Virginia Beach). Complaints document aggressive upselling, threats from owner/techs, $15,000 upsell attempts, and inexperienced workers.
Fraud Signals
Claims service in 50+ cities with no local staff; generic stock photos; free inspection bait; service area essentially all of Missouri and Illinois; URL typos suggest automated content generation
National lead-generation operation headquartered in Virginia Beach, VA with no St. Louis physical presence. The St. Louis page URL contains misspellings (“st-loius,” “moisuri”) consistent with automated content generation. BBB complaints from other markets document the owner or technicians threatening customers and pushing $15,000 upsells on customers who initially booked a “free inspection.” Matched 8+ fraud signals in our screening.
Do not hire. Virginia Beach-based lead-gen operation with documented BBB complaints describing threats and extreme bait-and-switch upselling. The local phone number routes to out-of-state dispatch.

Mr. Chimney Sweeping (mrchimneysweeping.com)

⚠ Confirmed Lead-Gen
Advertised Phone
(855) 630-2476 (toll-free only; hidden number: (715) 682-5937, Wisconsin)
Address
None listed anywhere
St. Louis Area Pages
East St. Louis IL, St. Charles MO, Fenton MO, Affton MO, Ballwin MO, Bellefontaine Neighbors MO, Berkeley MO, Belleville IL, and many more
Fraud Signals
Toll-free 855 number only; no physical address; 50+ city pages nationwide; identical boilerplate claiming “35 years serving our community” for communities nationwide; claims NFI-Certified without naming individuals; generic stock photos; classic lead-gen doorway page network
National lead-generation doorway page network with a Wisconsin phone number hidden behind an 855 toll-free line. Claims “35 years serving our community” for communities from DC to California to St. Louis to Connecticut, using identical boilerplate text. Has city-specific pages for at least 8 St. Louis metro communities. No physical address, no named individuals, no NFPA 211 references, no St. Louis neighborhood knowledge. Matched 10+ fraud signals.
Do not hire. Classic multi-state lead-gen doorway operation with no local staff or local presence. The Wisconsin hidden phone number confirms out-of-state routing.

A-1 Chimney Sweep (a-1chimneysweep.com)

⚠ BBB F Rating / Suspected Fraud
Phone
(866) 493-6688 (toll-free primary); local variants: (314) 417-3888, (314) 347-1333, (618) 239-4888 — different numbers per city page
Address
BBB lists only “Saint Louis, MO 63122” — no street address
BBB Status
NOT BBB Accredited. Rated F. Failure to respond to 4 complaints; 5 total complaints filed.
Fraud Signals
BBB F rating with unresolved complaints; toll-free 866 primary number; no physical street address; keyword-stuffed “A-1” name; identical template pages for 8+ metro cities; different phone numbers per city; claims “Certified Chimney Sweepers” without naming individuals or specific credentials
BBB-rated F operation with 5 complaints filed and a failure to respond to 4 of them. Uses a toll-free 866 number as the primary contact and deploys different local numbers on each city page as a local-SEO deception tactic. Template pages confirmed for O’Fallon, Wentzville, Arnold, Festus, Florissant, Ballwin, Collinsville, and O’Fallon IL. The BBB address contains no street number. Matched 8+ fraud signals.
Do not hire. BBB F rating with 5 complaints and 4 unresolved. Different phone numbers per city page is a confirmed spam tactic. No verifiable CSIA credentials.

Ace Fireplace Services / “Speedy Chimney”

⚠ Out-of-State Bait-and-Switch
Phone
(877) 507-2444 (toll-free only)
Contact Email
info@dfwfireplacesolutions.com (Dallas-Fort Worth confirmed)
BBB Address
9458 S 53rd Ct, Oak Lawn, IL 60453 (Chicago suburb — not St. Louis)
BBB Status
D+ rating (BBB of Chicago). File opened 5/5/2025. Failure to respond to 1 complaint.
Advertised Price
$79 chimney inspection (bait)
Fraud Signals
Toll-free 877 only; DFW-based website claiming St. Louis service; contact email reveals DFW origin; BBB address in Chicago suburb; D+ BBB rating; connected to “Speedy Chimney” (same phone, multiple business names); website says “Serving the Local Area” with no specificity; stock photo labeled “Chimney Sweep Dallas”; Yelp reviews from Fort Worth describe bait-and-switch with upselling; 12 fraud signals matched
Dallas-Fort Worth-based operation dispatching to St. Louis under the name “Ace Fireplace Services” and connected to “Speedy Chimney.” The contact email (info@dfwfireplacesolutions.com) reveals the Texas origin; the website title reads “The Best Fireplace Services in Dallas-Fort Worth, TX” while advertising St. Louis service. Yelp reviews from Fort Worth describe arrival followed by minimal work, then aggressive upselling of expensive “chemical” cleaning. BBB D+ with an unresolved complaint filed in 2025. Matched 12 fraud signals.
Do not hire. Dallas-based operation with documented bait-and-switch complaints in other markets, a BBB D+ rating, and a contact email revealing its DFW origin. The $79 inspection price is a bait offer.

Master Chimney Sweep & Fireplace Services (masterchimneysweeper.com)

⚠ Confirmed Lead-Gen
Phone
(866) 298-0872 (toll-free only)
Address
No local address
Website
Wix-hosted template site; St. Louis page: masterchimneysweeper.com/missouri/st-louis
Fraud Signals
Toll-free 866 only; no physical address; claims “The World’s Most Experienced Chimney Sweep Company”; Wix template site; has “Our Success with Seneer Capital” page (investment/franchise operation); multiple national location pages; stock imagery throughout; no NFPA 211 mentions; no St. Louis neighborhood knowledge; 8+ fraud signals
Wix-hosted template operation claiming to be “The World’s Most Experienced Chimney Sweep Company” with no verifiable address or staff. Has a dedicated St. Louis city page with no local content. The presence of a page titled “Our Success with Seneer Capital” suggests an investor-funded lead-gen roll-up. National location pages span multiple states. Matched 8+ fraud signals.
Do not hire. Wix-template national lead-gen operation with no local presence, no verifiable address, and no NFPA 211 knowledge in content.

[City]ChimneySweep.us Domain Network

⚠ Fake GBP Network
Confirmed Domains
saintlouischimneysweep.us, saintcharleschimneysweep.us, florissantchimneysweep.us, wentzvillechimneysweep.us, pacificchimneysweep.us, edwardsvillechimneysweep.us, ofallonchimneysweep.us, ofallonchimenysweep.us (misspelled), granitecitychimneysweep.us, eastsaintlouischimneysweep.us, altonchimneysweep.us, and more
Also Connected
chimneyssweepstlouis.com (double “s”), chimneysweepsaintlouis2025.wordpress.com
Phones
Different numbers per city: (314) 673-1007 (St. Louis); (618) area codes for IL cities
Address
“Saint Louis, Missouri” only — no street address on any domain
Fraud Signals
14+ keyword-stuffed domain names; no physical addresses; identical template design across all; different phone per city (local-SEO deception); WordPress.com blog for SEO spam (posts started Sept/Oct 2025); “network of pros” language confirms not a real company; misspelled domain registrations suggest automated mass registration; no CSIA, NFPA 211, or neighborhood knowledge; 9+ fraud signals
A network of at least 14 keyword-stuffed .us domains targeting every major St. Louis metro community including St. Louis, St. Charles, Florissant, Wentzville, Pacific, Edwardsville, O’Fallon, Granite City, East St. Louis, and Alton. All domains use identical template designs with different phone numbers assigned to each city for local search manipulation. Misspelled variants (ofallonchimenysweep.us, granitecitychimenysweep.us) indicate automated bulk registration. A free WordPress.com blog was created in late 2025 to generate backlinks. There is no real business entity behind this network.
Do not hire. This is not a real business — it is a lead-generation domain network designed to appear as a local company in search results. Any calls made to these numbers will be routed to unknown third parties.

[City] Chimney & Fireplace Services Domain Network

⚠ Fake GBP Network
Confirmed Domains
chimneyfireplaceedwardsville.com, chimneyfireplacebelleville.com, chimneyfireplacecollinsville.com, chimneyfireplacestlouis.com
Address
None on any domain
Fraud Signals
Identical templates across all domains; keyword-stuffed domain names; no verifiable addresses; no owner information; no phone numbers on some; grammar errors consistent with auto-generated text; Wikipedia city descriptions copy-pasted as filler content; 7+ fraud signals
A second domain network operating four keyword-stuffed city-specific .com domains across the Metro East Illinois and Missouri St. Louis market. Pages use auto-generated text with grammar errors and Wikipedia content copy-pasted as filler. No owner information, no phone numbers on some domains, and no verifiable business entity. Distinct from but using the same tactics as the [city]chimneysweep.us network above.
Do not hire. Template website network with no real business entity, no contact information on some domains, and auto-generated filler content.