Certified Chimney Sweeps in St. Louis, MO — 14 CSIA-Certified Companies Verified
St. Louis presents one of the most demanding chimney markets in the country. The bi-state metro (Missouri and Illinois Metro East) is built on a dense fabric of 19th- and early-20th-century masonry housing—neighborhoods like Soulard (1840s–1880s), Lafayette Square (1860s–1890s), Tower Grove, The Hill, and Central West End contain block after block of original clay-brick chimneys requiring regular maintenance. The freeze-thaw cycle in the Missouri River Valley is severe, with temperatures routinely swinging 40–50°F in a single day during shoulder seasons, accelerating mortar deterioration and spalling at an above-average rate. Our research confirmed 14 CSIA-certified companies serving the metro, anchored by two of the most credentialed operators in the entire Midwest: Gregg Boss of English Sweep (the only CSIA Master Chimney Sweep in Missouri, in business since 1979) and Victor Imgarten of Clean Sweep Chimney Service (the longest CSIA-certified sweep in Missouri and a past president of both the NCSG and CSIA, in business since 1978).
Missouri imposes no statewide contractor licensing for chimney sweeps, making the St. Louis market uniquely vulnerable to fraud. Our research documented 13 or more confirmed or suspected spam and lead-generation operations actively targeting metro ZIP codes—including a Virginia Beach company (chimneysweep.com) with BBB complaints describing threats and $15,000 upsell attempts, a Dallas-based operation (Ace Fireplace Services) with a BBB D+ rating dispatching to St. Louis without local staff, an F-rated operator (A-1 Chimney Sweep) with unresolved BBB complaints, and a network of at least 14 keyword-stuffed “[city]chimneysweep.us” doorway domains with no verifiable business entities behind them. Documented fraudulent operations outnumber CSIA-certified companies in search results for most St. Louis ZIP codes. Missouri’s zero-licensing environment means any company can claim “certified” with no legal consequence.
Every company in this directory was evaluated through CSIA credential verification via search.csia.org (confirmed profile URLs where available), NCSG member directory cross-reference, BBB accreditation history, physical address verification, multi-platform review analysis, and phone number ownership patterns. Only CSIA- and NCSG-confirmed companies or thoroughly verified long-standing operators appear in the non-flagged tiers. Any company using a toll-free-only number, lacking a verifiable street address, or matching multiple spam signals from our 12-point checklist is documented in the flagged section. Legitimate chimney cleaning in St. Louis costs $179–$300+; any advertised price below $100 should be treated as a bait-and-switch indicator.
English Sweep, Inc.
938 St. Louis Ave, Valley Park, MO 63088
St. Louis County, St. Charles County, Franklin County, Jefferson County, Monroe County IL, Washington County IL
CCS (confirmed — search.csia.org/company_profile/english-sweep-inc); Owner Gregg Boss holds CSIA Master Chimney Sweep — the only one in Missouri
Yes — multiple NFI-certified sweeps on staff
NCSG Voting Member; NCSG Honorary Master Chimney Professional; ASHI Member; Midwest Chimney Safety Council; West St. Louis County Chamber of Commerce
Gregg Boss (owner since 1983)
47 years (since 1979); largest certified crew in the St. Louis area
All 3 NFPA 211 inspection levels, chimney construction, emergency services, fireplace sales (Bellfires, Prior, Cozy Heat, Empire, Heat & Glo), smoking fireplace diagnostics, water-damaged wall repair, gas/utility cease orders, dryer vent cleaning, air duct cleaning
Clean Sweep Chimney Service
4004 Emerald Drive, St. Charles, MO 63304
St. Louis County, St. Charles County
CCS — Owner Victor Imgarten is the longest CSIA-certified chimney sweep in Missouri and a past president of both the NCSG and CSIA
Yes (NFI certified)
NCSG Voting Member; NCSG Honorary Master Chimney Professional; NCSG President’s Award; Leavitt Award; Groah-Bures Award
Victor Imgarten
48 years (since 1978) — St. Louis’ oldest chimney sweep service; 50,000+ chimneys serviced
Historical chimney renovations, IR camera/blower door testing for smoke problems, HEPA vacuum systems, fireplace construction, chimney relining, European chimney lining/sweeping methods, power sweeping, video chimney inspections
The Mad Hatter Service Company
1109 E Terra Ln, O’Fallon, MO 63366
St. Louis County, St. Charles County
CCS (confirmed — search.csia.org/company_profile/the-mad-hatter-of-mo)
dba A & J Mack Enterprises Inc.
Annie Mack, Kim Boldt, Joe Mack Sr.
40+ years; 80,000+ clients served
Chimney sweeping, air duct cleaning, dryer vent cleaning, chimney repair, tuckpointing, inspections; also operates “The Chimney Safety Firm” — a forensic-level diagnostic/inspection division
STL Chimney / St. Louis Chimney Co.
120 N. Main Street, St. Charles, MO 63301
Bi-state — Missouri and Illinois (explicitly stated)
Employs CSIA-certified technicians (confirmed — search.csia.org/company_profile/stl-chimney)
NCSG Voting Member
Founded 2013; 10,000+ chimneys serviced
Chimney sweeping/cleaning, inspections, gas fireplace services (direct vent, gas inserts, gas logs), exterior masonry repairs, chimney chase covers, custom chimney caps, flue liner installation (stainless steel, aluminum, Cerfractory), dryer vent cleaning, tuckpointing, crown repair, brick rebuilds
All Gas Installation and Fireplace
1 Ferndale Dr, Fenton, MO 63026
St. Louis metro, Jefferson County, Franklin County, St. Charles County
CSIA Certified Chimney Sweep + CCP Certified Master Chimney Technician
NFI Certified Gas Specialist
NCSG Member; Midwest Hearth Patio & Barbecue Association member
A+ (Accredited)
20+ years
Gas fireplace specialist: wood-to-gas conversions, gas log/fireplace sales/service/repair, chimney sweeps, home sale inspections, chimney caps, chase covers, fireplace remote controls, gas grill sales & service, gas light/lamp/lantern service. No subcontractors used.
Bone Dry Roofing St. Louis
5895 Suemandy Dr, St. Peters, MO 63376
St. Louis, St. Charles, and surrounding communities
Employs CSIA-certified technicians (confirmed — search.csia.org/company_profile/bone-dry-roofing-st-louis)
National company with local St. Louis branch
Chimney repair, chimney inspection, chimney cleaning/sweeping, chimney caps/covers, masonry services, chimney rebuild; also roofing, siding, insulation, gutters
The Chimney Sweep Experts
10635 Liberty Ave, St. Louis, MO 63132
Bi-state — full MO metro plus Madison County IL, St. Clair County IL, Alton, Belleville, Caseyville, Collinsville, East St. Louis, Edwardsville, Fairview Heights, Granite City, Highland IL
CSIA certified (claimed); NCSG Voting Member confirmed at ncsg.org/member/the-chimney-sweep-experts-2
Omar A. Quijada
A+ (Accredited since 2019)
Est. 2017; personnel with 16+ years chimney experience
Chimney cleaning/visual inspection, camera inspection, cap installation, troubleshooting, damper installation, tuckpointing, masonry water repellent, tear-down/rebuild, flue liners, dryer vent cleaning; Level 1 and 2 NFPA inspections
SirVent STL Chimney & Venting Service
Based in Jackson, MO 63755 (per BBB/Yelp); serves St. Louis metro
St. Louis County, St. Louis City, Jefferson County, Sainte Genevieve, Perry, Cape Girardeau, Scott, St. Francois, Bollinger counties
CSIA certified per website; listed on legacy web.ncsg.org directory (current ncsg.org listing not confirmed — membership may have lapsed)
SirVent franchise operation; military family (Mike and Afton, father/son)
BBB Torch Award for Ethics 2022
Chimney sweeping, inspections, chimney repairs, masonry repairs, chimney relining, waterproofing, dryer vent cleaning, chase cover replacement, chimney cap replacement, flashing, crown repair, smoke chamber repair, energy top dampers
Welsch Chimney Service Inc.
St. Louis, St. Charles, St. Peters, Florissant, Chesterfield, Clayton, University City, Cottleville, O’Fallon
CSIA member with certified team (claimed)
38 years (since 1988), family-owned
No-mess chimney cleaning, masonry & leak repair, stainless steel chimney caps, top-sealing dampers, flue & chimney liner repair, smoke & draft solutions, animal removal, dryer vent and furnace flue cleaning, Level 1/2 inspections with written reports
Gateway Chimney Service, LLC
6810 Scanlan Ave, Saint Louis, MO 63139
St. Louis metropolitan area (bi-state based on Angi/Yelp IL appearances)
CSIA certified chimney sweeps (claimed)
Mike (referenced in reviews)
40+ years, family-owned
Chimney cleaning, inspection, repair, restoration, cap/crown installation, gas and wood insert maintenance, flue liner solutions, masonry work
Fireside Hearth & Home (Arnold Stove & Fireplace Center)
Arnold, MO (Jefferson County — showroom)
Jefferson County, southern St. Louis County
CSIA certified in-house chimney sweeps (not subcontracted)
NCSG Member
Moss family
40 years (since 1986), family-owned
Chimney sweeping/cleaning, Level 2 camera inspections, real estate chimney inspections, wood stove/fireplace/insert sales; 80+ burning displays in showroom
Maine Chimney Sweep Ltd.
2010 East B Street, Belleville, IL 62221
Illinois Metro East only — Belleville, Collinsville, Edwardsville, Fairview Heights, Granite City, O’Fallon IL, Swansea, Shiloh, Highland, Troy, Glen Carbon, Alton, Caseyville, Cahokia, Columbia, Waterloo, Mascoutah
CSIA certified (confirmed — search.csia.org/company_profile/maine-chimney-sweep-ltd)
NCSG Member
Austin Hayden
A+ (Accredited; file opened 2003)
47 years (since 1979)
Chimney cleaning/sweeping, camera inspections, visual inspections, chimney cover installation, fireplace installation/insert installation, chimney/fireplace repair, animal & nesting removal, dryer vent cleaning, masonry repair, chimney liners & inserts, chimney covers/crowns, product sales
Wiegmann Woodworking & Fireplaces, Inc.
105 Sugar Creek Ln, Damiansville, IL 62215
Damiansville, Breese, New Baden, Trenton, Lebanon, Mascoutah, Edwardsville, Highland, Fairview Heights, Shiloh, Maryville, Mt. Vernon
Two CSIA Certified Chimney Sweeps on staff: Todd Busch, CCS, CSIA License #7908 (certified since April 2012)
NFI Gas & Woodburning certified employees
NCSG Member; HPBA Member
Teresa A. Wiegmann; veteran/family-owned
A+ (Accredited)
Incorporated 1999
Fireplace sales/installation (wood-burning, gas, pellet), chimney sweeping and inspections (Level 1 & 2), custom fireplaces, custom mantels, outdoor kitchens, doors & trim, stone/marble work; 50+ working displays in showroom. Payment for chimney services: cash or check only.
Home & Leisure Lifestyles, LLC
30 Stone Dr, Highland, IL 62249 (home-based, by appointment only)
Highland, Edwardsville, Collinsville, O’Fallon IL, and broader Metro East
CSIA member (confirmed)
NFI Certified (Gas and Wood fireplace installation)
NCSG Voting Member (confirmed at ncsg.org/member/home-leisure-lifestyles-llc-2)
Tom Vice (President, 30+ years experience); Nathan Vice
A+
Founded 2003
Regency, Vermont Casting, White Mountain Hearth, Blaze King
Chimney cleaning, inspections, tuckpointing, waterproofing, masonry repairs, video inspections, chimney/gas fireplace installations, fire safety inspections, pellet/wood/gas stove installation and service, dryer vent cleaning, duct cleaning
A.I.O Pro Chimney (All In One Pro)
4826 Pennsylvania Avenue, St. Louis, MO 63111
Greater St. Louis area
Voting Member (confirmed at ncsg.org/member/a-i-o-pro-chimney)
Inspections, sweeping, relining, dryer vent cleaning, installation, masonry repair, chimney caps, crown repair, waterproofing, brick sealing, fireplace restoration, animal removal, air duct cleaning, gas fireplace repair/installation, stainless steel liner installation, chase cover replacement, emergency services
Holy Smoke Chimney Service
105 N Main Street, Suite 102, St. Charles, MO 63301 (NCSG); also 6859 Bear Creek Dr, Saint Louis, MO 63129 (BBB)
St. Louis and Metro East (per NCSG: “across St. Louis and Metro East”)
Voting Member (confirmed at ncsg.org/member/holy-smoke-chimney-service)
A+ (Accredited since 2016)
Holy Smoke STL LLC
40+ years (per NCSG bio); 30+ years (per BBB)
Tuckpointing, waterproofing, chimney caps and covers, chase caps, inspections, cleanings
Chimneys Unlimited
1031 Woodland Trails Dr, Fenton, MO 63026
Fenton, Chesterfield, Wildwood, Kirkwood, Webster Groves, Creve Coeur, Ballwin, Manchester, Town and Country, Ladue, Sunset Hills, Mehlville, Oakville
None claimed
A+
Bob (38+ years experience)
30+ years
Chimney inspections, chimney cleaning, chase top covers, chimney covers, dryer vent cleaning, tuckpointing, brick & stonework, mortar repair, damper repairs & installation, fireplace door repairs & installation, bird/squirrel guards. Fully insured.
Ash Wipers Chimney Sweep Inc.
741 Castle Ridge Dr, Ballwin, MO 63021
Ballwin, Brentwood, Chesterfield, Clayton, Crestwood, Creve Coeur, Fenton, Glendale, Kirkwood, Ladue, Manchester, Mehlville, Oakville, Rock Hill, Sappington, Shrewsbury, Sunset Hills, Town and Country, University City, Valley Park, Warson Woods, Webster Groves, Wildwood, Winchester, St. Louis
None claimed
Accredited member
33 years (since 1993), family-owned
Chimney cleaning, inspections, repairs, total rebuilding
Ashes Away Chimney Service
House Springs / High Ridge, MO 63049 (Jefferson County)
St. Louis & northern Jefferson County
Certified for Level 1, 2 & 3 chimney inspections; Gas, Pellet & Wood certified specialist (per Angi)
Accredited
4.8/5 on Angi; 4.5 stars on Yelp
~40 years, father & son company
~$279 for cleaning; $20 multi-chimney discount
Chimney cleaning, inspections (all 3 levels), chimney repair, chimney cap installation, damper repair, camera inspections, masonry repair, stove removal/disposal
Scott's Chimney Service
Dittmer, MO (Jefferson County/Franklin County area)
Jefferson County, St. Louis County, Franklin County, St. Charles County
Kirk Scott
A+
References CSIA recommendations; does not explicitly claim certification
40+ years
$189 sweep + inspection; $150 inspection only
Chimney sweeping, flue brushing, damper repair, chimney crown repair (CrownSeal® with 10-year warranty), waterproofing, chimney cap installation, wood stove installation (Lopi, Napoleon brands), dryer vent cleaning
Approved Home Improvements (AHI)
St. Louis County, Jefferson County; Ballwin, Oakville, St. Charles neighborhoods referenced
James (meets every homeowner personally)
A+
HeatShield Certified Installer; Veteran-Owned Business
35+ years (since 1991)
$179 chimney sweep (promotional)
Chimney sweeping, chimney repair, tuckpointing, camera inspections, dryer cleaning, stucco chimney repair, flue liner replacement, full masonry restoration, waterproofing, crown repair, damper repair/replacement
Clean Sweep Chimney Services Inc.
30 Ramsgate, Collinsville, IL 62234
Bi-state — Collinsville, St. Louis, East St. Louis, Belleville, Fairmont City, Troy
Clay
CSIA Certified Chimney Sweep badge on website (not independently confirmed on search.csia.org)
~16 years (established 2010)
Chimney cleaning, chimney repair, chimney caps, tuckpointing, flashing repair, dryer vent cleaning/repair, fireplace maintenance, chimney liners, crown repair, waterproofing
Hearth & Home Service & Construction
3624 George Leilich Road, New Athens, IL 62264
New Athens area, greater Metro East — Belleville, O’Fallon, Mascoutah, Freeburg, Red Bud, Smithton (St. Clair County)
Joseph Bolin
A+ (Accredited since 2004)
Not explicitly claimed; insured and bonded
Started sweeping 1982; building/restoring 1977; 44+ years sweeping experience
Travis Industries (Fireplace Xtrordinair, Lopi, DaVinci, Avalon)
Chimney sweep & cleaning, chimney repair, custom fireplace design, heating unit sales, chimney liners, rain caps, water leak repairs, gas and wood fireplace/stove installation, air duct cleaning, fireplace remodeling, chimney inspection
Show more listings
A Step in Time Chimney Sweep (chimneysweep.com)
(314) 244-6639 (local redirect only; HQ: (757) 244-6639, Virginia Beach, VA)
696 S Rosemont Rd, Virginia Beach, VA 23452 — no St. Louis physical address
chimneysweep.com (St. Louis page URL contains misspellings: “st-loius” and “moisuri”)
NOT BBB Accredited (Virginia Beach). Complaints document aggressive upselling, threats from owner/techs, $15,000 upsell attempts, and inexperienced workers.
Claims service in 50+ cities with no local staff; generic stock photos; free inspection bait; service area essentially all of Missouri and Illinois; URL typos suggest automated content generation
Mr. Chimney Sweeping (mrchimneysweeping.com)
(855) 630-2476 (toll-free only; hidden number: (715) 682-5937, Wisconsin)
None listed anywhere
East St. Louis IL, St. Charles MO, Fenton MO, Affton MO, Ballwin MO, Bellefontaine Neighbors MO, Berkeley MO, Belleville IL, and many more
Toll-free 855 number only; no physical address; 50+ city pages nationwide; identical boilerplate claiming “35 years serving our community” for communities nationwide; claims NFI-Certified without naming individuals; generic stock photos; classic lead-gen doorway page network
A-1 Chimney Sweep (a-1chimneysweep.com)
(866) 493-6688 (toll-free primary); local variants: (314) 417-3888, (314) 347-1333, (618) 239-4888 — different numbers per city page
BBB lists only “Saint Louis, MO 63122” — no street address
NOT BBB Accredited. Rated F. Failure to respond to 4 complaints; 5 total complaints filed.
BBB F rating with unresolved complaints; toll-free 866 primary number; no physical street address; keyword-stuffed “A-1” name; identical template pages for 8+ metro cities; different phone numbers per city; claims “Certified Chimney Sweepers” without naming individuals or specific credentials
Ace Fireplace Services / “Speedy Chimney”
(877) 507-2444 (toll-free only)
info@dfwfireplacesolutions.com (Dallas-Fort Worth confirmed)
9458 S 53rd Ct, Oak Lawn, IL 60453 (Chicago suburb — not St. Louis)
D+ rating (BBB of Chicago). File opened 5/5/2025. Failure to respond to 1 complaint.
$79 chimney inspection (bait)
Toll-free 877 only; DFW-based website claiming St. Louis service; contact email reveals DFW origin; BBB address in Chicago suburb; D+ BBB rating; connected to “Speedy Chimney” (same phone, multiple business names); website says “Serving the Local Area” with no specificity; stock photo labeled “Chimney Sweep Dallas”; Yelp reviews from Fort Worth describe bait-and-switch with upselling; 12 fraud signals matched
Master Chimney Sweep & Fireplace Services (masterchimneysweeper.com)
(866) 298-0872 (toll-free only)
No local address
Wix-hosted template site; St. Louis page: masterchimneysweeper.com/missouri/st-louis
Toll-free 866 only; no physical address; claims “The World’s Most Experienced Chimney Sweep Company”; Wix template site; has “Our Success with Seneer Capital” page (investment/franchise operation); multiple national location pages; stock imagery throughout; no NFPA 211 mentions; no St. Louis neighborhood knowledge; 8+ fraud signals
[City]ChimneySweep.us Domain Network
saintlouischimneysweep.us, saintcharleschimneysweep.us, florissantchimneysweep.us, wentzvillechimneysweep.us, pacificchimneysweep.us, edwardsvillechimneysweep.us, ofallonchimneysweep.us, ofallonchimenysweep.us (misspelled), granitecitychimneysweep.us, eastsaintlouischimneysweep.us, altonchimneysweep.us, and more
chimneyssweepstlouis.com (double “s”), chimneysweepsaintlouis2025.wordpress.com
Different numbers per city: (314) 673-1007 (St. Louis); (618) area codes for IL cities
“Saint Louis, Missouri” only — no street address on any domain
14+ keyword-stuffed domain names; no physical addresses; identical template design across all; different phone per city (local-SEO deception); WordPress.com blog for SEO spam (posts started Sept/Oct 2025); “network of pros” language confirms not a real company; misspelled domain registrations suggest automated mass registration; no CSIA, NFPA 211, or neighborhood knowledge; 9+ fraud signals
[City] Chimney & Fireplace Services Domain Network
chimneyfireplaceedwardsville.com, chimneyfireplacebelleville.com, chimneyfireplacecollinsville.com, chimneyfireplacestlouis.com
None on any domain
Identical templates across all domains; keyword-stuffed domain names; no verifiable addresses; no owner information; no phone numbers on some; grammar errors consistent with auto-generated text; Wikipedia city descriptions copy-pasted as filler content; 7+ fraud signals